PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10007882m
Common NameEUTSA_v10007882mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 389aa    MW: 43090.9 Da    PI: 8.3726
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10007882mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.81e-40175251177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +Cq++gCe dls+ak+yhr+h+vCe+hsk+p+v+vsgle+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
  Thhalv10007882m 175 RCQIDGCELDLSSAKDYHRKHRVCEKHSKSPKVTVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQ 251
                      6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-32169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.197173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37175251IPR004333Transcription factor, SBP-box
PfamPF031102.2E-31176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MDCNMRSPLP WDWENLIMSN PSKTESDRKQ LSTEWETEKG EGIESIVPYF SSFEKVCSGS  60
ATSFWQTDVS KSSQSTSINS SSPEVKVCKA ASESSPGVSC SNIDFVQVKA STAPEVSAAS  120
AESDLCLELG KRTYSEELWG RKNNDISAVS MKLLTPSVVA RKKSKPCGQS IQISRCQIDG  180
CELDLSSAKD YHRKHRVCEK HSKSPKVTVS GLERRFCQQC SRFHAVSEFD EKKRSCRKRL  240
SHHNARRRKP QGVFPLNPER MYDRRQTNMA WNGLSLNSRS EEKYAWGTTY DTKPAQTESG  300
FTLSFQRGNG SEEQLFASSS HSFSAHQTSG GFSAGKSKFQ LHGEGVGECS GVLHESQDFH  360
RALSLLSTSS DSHAQPVSLL FSYDGVPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-271762491184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231248KKRSCRKRLSHHNARRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAPTransfer from AT1G27360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533920.0AK353392.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-42-E20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415772.10.0hypothetical protein EUTSA_v10007882mg
RefseqXP_006415773.10.0hypothetical protein EUTSA_v10007882mg
SwissprotQ9FZK00.0SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLE4MXZ50.0E4MXZ5_EUTHA; mRNA, clone: RTFL01-42-E20
TrEMBLV4MQY30.0V4MQY3_EUTSA; Uncharacterized protein
STRINGscaffold_103051.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50041653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.40.0squamosa promoter-like 11